Antibodies

View as table Download

Rabbit polyclonal Anti-Aquaporin 5

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DHREERKKTIELTAH corresponding to amino acid residues 251-265 of rat AQP5? ?. Intracellular, C-terminus.? ?Â

Rabbit Polyclonal Anti-AQP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AQP5 Antibody is: synthetic peptide directed towards the C-terminal region of Human AQP5. Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE

AQP5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human AQP5 (NP_001642.1).
Modifications Unmodified

AQP5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human AQP5 (NP_001642.1).
Modifications Unmodified