Rabbit Polyclonal Anti-ARL6IP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARL6IP4 Antibody is: synthetic peptide directed towards the middle region of Human ARL6IP4. Synthetic peptide located within the following region: SSSSSSDGRKKRGKYKDKRRKKKKKRKKLKKKGKEKAEAQQVEALPGPSL |
Rabbit Polyclonal Anti-ARL6IP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARL6IP4 Antibody is: synthetic peptide directed towards the middle region of Human ARL6IP4. Synthetic peptide located within the following region: SRSRGRGSEKRKKKSRKDTSRNCSASTSQERSKQKARRRTRSSSSSSSSS |
ARL6IP4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARL6IP4 |
ARL6IP4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China