Rabbit Polyclonal Anti-ELA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELA1 antibody: synthetic peptide directed towards the N terminal of human ELA1. Synthetic peptide located within the following region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT |
Rabbit Polyclonal Anti-Ela1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ela1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV |
Germany
Japan
United Kingdom
China