Cela1 Rabbit Polyclonal Antibody

CAT#: TA340039

Rabbit Polyclonal Anti-Ela1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Cela1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Ela1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name chymotrypsin-like elastase family, member 1
Background The function remains unknown.
Synonyms ELA1; Elastase-1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Mouse: 92%; Rabbit: 86%; Pig: 85%; Horse: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.