Antibodies

Jump to Filters
View as table Download
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA313697

USD 345.00

4 Weeks

Rabbit polyclonal anti-CSF2RA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CSF2RA.
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA338295

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSF2RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF2RA antibody is: synthetic peptide directed towards the C-terminal region of Human CSF2RA. Synthetic peptide located within the following region: VLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIW
GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody [Clone ID: OTI3E6]
CF812523

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSF2RA mouse monoclonal antibody,clone OTI3E6

Applications WB
Reactivities Human
Conjugation Unconjugated
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA323988

USD 345.00

In Stock

Anti-CSF2RA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-320 amino acids of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA323989

USD 345.00

In Stock

Anti-CSF2RA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 386-400 amino acids of Human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA323990

USD 345.00

In Stock

Anti-CSF2RA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 386-400 amino acids of Human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA375135

USD 220.00

3 Weeks

CSF2RA Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1).
Modifications Unmodified
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA375136

USD 220.00

3 Weeks

CSF2RA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-320 of human CSF2RA (NP_758448.1).
Modifications Unmodified