Goat Polyclonal Antibody against DBNL
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AANLSRNGPALQE-C, from the N Terminus of the protein sequence according to NP_054782.2; NP_001014436.1. |
Goat Polyclonal Antibody against DBNL
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AANLSRNGPALQE-C, from the N Terminus of the protein sequence according to NP_054782.2; NP_001014436.1. |
Rabbit Polyclonal Anti-DBNL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DBNL antibody: synthetic peptide directed towards the middle region of human DBNL. Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE |
DBNL Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 131-430 of human DBNL (NP_001014436.1). |
Modifications | Unmodified |
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |