Antibodies

View as table Download

Goat Polyclonal Antibody against DBNL

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence AANLSRNGPALQE-C, from the N Terminus of the protein sequence according to NP_054782.2; NP_001014436.1.

Rabbit Polyclonal Anti-DBNL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBNL antibody: synthetic peptide directed towards the middle region of human DBNL. Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE

DBNL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-430 of human DBNL (NP_001014436.1).
Modifications Unmodified

DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated