Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-ESRRB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: RHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANG |
Rabbit Polyclonal Anti-ESRRB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody,clone OTI12B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ESRRB Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ESRRB |
ESRRB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3). |
| Modifications | Unmodified |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody,clone OTI12B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody,clone OTI12B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ESRRB
Applications
- WB
Conjugates
- Unconjugated