Estrogen Related Receptor beta (ESRRB) Rabbit Polyclonal Antibody

CAT#: TA330220

Rabbit Polyclonal Anti-ESRRB Antibody

Product Images

WB Suggested Anti-ESRRB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

• 

  Lanes : Lane 1: 25ug mouse ES cellsLane 2: 25ug mouse ES cells overexpressing FLAG EsrrB (mouse)Lane 3: 25ug chromatin fraction CV1 cellsLane 4: 25ug chromatin fraction CV1 cells overexpressing FLAG EsrrB (mouse)Lane 5: 25ug chromatin fraction CV1 cells o

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: estrogen related receptor beta
• Database Link:
  NP_004443
  Entrez Gene 26380 MouseEntrez Gene 2103 Human
  UniProt ID O95718
• Background: ESRRB encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. Sequence Note: The sequence AF094517.1 is from a chimeric clone. Only the ESRRB sequence was propagated into this RefSeq record. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: DFNB35; ERR2; ERRb; ESRL2; NR3B2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors