Antibodies

View as table Download

ESRRB rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ESRRB

Rabbit Polyclonal ESRRB Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ESRRB antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ESRRB.

ESRRB / ERR-Beta Rabbit Polyclonal (Ligand-binding Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen ESRRB / ERR Beta antibody was raised against synthetic 15 amino acid peptide from ligand-binding domain of human ESRRB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Mouse, Rat, Elephant, Turkey, Chicken, Lizard (93%); Bat (87%); Stickleback, Medaka, Pufferfish, Zebrafish (80%).

Rabbit Polyclonal anti-ESRRB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: RHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANG

Rabbit Polyclonal Anti-ESRRB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS

Rabbit Polyclonal Anti-ESRRB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ESRRB

ESRRB Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ESRRB

ESRRB Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3).
Modifications Unmodified