Antibodies

View as table Download

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Goat Polyclonal Antibody against ESRRG

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRMSNKDRHIDS, from the internal region of the protein sequence according to NP_001429.2; NP_996317.1; NP_996318.1.

Rabbit polyclonal ESRRG Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ESRRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 189-221 amino acids from the Central region of human ESRRG.

Rabbit Polyclonal Anti-Esrrg Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Esrrg antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML

Carrier-free (BSA/glycerol-free) ESRRG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ESRRG mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ESRRG mouse monoclonal antibody, clone OTI6G1 (formerly 6G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ESRRG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ESRRG

ESRRG Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2).
Modifications Unmodified

ESRRG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2).
Modifications Unmodified

ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI6G1 (formerly 6G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI6G1 (formerly 6G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated