Rabbit Polyclonal Anti-GABA(A) ?2 (extracellular)
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RKRWTGHLETSKPSH, corresponding to amino acid residues 51-65 of rat GABA(A) ?2. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GABA(A) ?2 (extracellular)
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RKRWTGHLETSKPSH, corresponding to amino acid residues 51-65 of rat GABA(A) ?2. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GABRR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY |
GABRR2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human GABRR2 (NP_002034.3). |
Modifications | Unmodified |