Antibodies

View as table Download

Rabbit Polyclonal KIF5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KIF5 antibody was raised against a 20 amino acid synthetic peptide from near the carboxy terminus of human KIF5. The immunogen is located within amino acids 880 - 930 of KIF5.

Rabbit Polyclonal KIF5 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KIF5 antibody was raised against a 20 amino acid peptide from near the center of human KIF5.

Rabbit Polyclonal Anti-KIF5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF5A antibody: synthetic peptide directed towards the middle region of human KIF5A. Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH

KIF5A Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2).
Modifications Unmodified