Chicken Polyclonal LDL-R Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LDL-R antibody was raised against an 18 amino acid peptide near the center of human LDL-R. |
Chicken Polyclonal LDL-R Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LDL-R antibody was raised against an 18 amino acid peptide near the center of human LDL-R. |
Rabbit Polyclonal LDL R Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human LDL Receptor protein (within residues 500-550). [Swiss-Prot# P01130] |
Rabbit Polyclonal Anti-LDLR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA |
LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LDLR mouse monoclonal antibody,clone OTI4E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LDLR mouse monoclonal antibody,clone OTI8D12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LDLR mouse monoclonal antibody,clone OTI7C5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDL Receptor (LDLR) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human LDL Receptor (LDLR) (NP_000518.1). |
Modifications | Unmodified |
LDLR mouse monoclonal antibody,clone OTI4E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI4E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI8D12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI8D12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI7C5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI7C5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |