Antibodies

View as table Download

Rabbit polyclonal MEKKK 1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MEKKK 1.

Goat Polyclonal Antibody against MAP4K1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DVVDPDIFNRDPR-C, from the N Terminus of the protein sequence according to NP_009112.

Rabbit Polyclonal Anti-MAP4K1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K1 antibody: synthetic peptide directed towards the N terminal of human MAP4K1. Synthetic peptide located within the following region: VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK

MAP4K1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human MAP4K1