MAP4K1 Rabbit Polyclonal Antibody

CAT#: TA338986

Rabbit Polyclonal Anti-MAP4K1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MAP4K1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAP4K1 antibody: synthetic peptide directed towards the N terminal of human MAP4K1. Synthetic peptide located within the following region: VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 90 kDa
Gene Name mitogen-activated protein kinase kinase kinase kinase 1
Background MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.
Synonyms HPK1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 83%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways MAPK signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.