MAP4K1 Rabbit Polyclonal Antibody

CAT#: TA338986

Rabbit Polyclonal Anti-MAP4K1 Antibody

Product Images

WB Suggested Anti-MAP4K1 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate.MAP4K1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAP4K1 antibody: synthetic peptide directed towards the N terminal of human MAP4K1. Synthetic peptide located within the following region: VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: mitogen-activated protein kinase kinase kinase kinase 1
• Database Link:
  NP_001036065
  Entrez Gene 11184 Human
  UniProt ID Q92918
• Background: MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.
• Synonyms: HPK1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway