Germany
Japan
United Kingdom
China
MAP4K1 mouse monoclonal antibody, clone 2A1, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human |
Antibodies
View as table Download
Rabbit polyclonal MEKKK 1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEKKK 1. |
Goat Polyclonal Antibody against MAP4K1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DVVDPDIFNRDPR-C, from the N Terminus of the protein sequence according to NP_009112. |
Rabbit Polyclonal Anti-MAP4K1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP4K1 antibody: synthetic peptide directed towards the N terminal of human MAP4K1. Synthetic peptide located within the following region: VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK |
Anti-MAP4K1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of human mitogen-activated protein kinase kinase kinase kinase 1 |
MAP4K1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human MAP4K1 |
Active filters
Target Symbol
- MAP4K1