Rabbit Polyclonal Anti-MED16 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED16 antibody is: synthetic peptide directed towards the middle region of Human MED16. Synthetic peptide located within the following region: IVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWI |
Rabbit Polyclonal Anti-MED16 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MED16 antibody: synthetic peptide directed towards the C terminal of human MED16. Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS |
Rabbit Polyclonal Anti-THRAP5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THRAP5 antibody: synthetic peptide directed towards the C terminal of human THRAP5. Synthetic peptide located within the following region: RLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKAC |
Rabbit Polyclonal anti-MED16 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MED16 antibody: synthetic peptide directed towards the N terminal of human MED16. Synthetic peptide located within the following region: FGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAF |
Germany
Japan
United Kingdom
China
