Antibodies

View as table Download

Rabbit Polyclonal Anti-Neuropeptide Y2 Receptor

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CEQRLDAIHCSEVSMTFKAK, corresponding to amino acid residues 346-364 of mouse NPY2R. Intracellular, C-terminus.

Rabbit polyclonal anti-NPY2R antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPY2R.

Goat Polyclonal Antibody against Npy2r

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KAKKNLEVKKNN, from the internal region of the protein sequence according to NP_032757.1.

Rabbit Polyclonal anti-NPY2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY2R antibody is: synthetic peptide directed towards the N-terminal region of Human NPY2R. Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV

NPY2R Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human NPY2R (NP_000901.1).