Rabbit anti-OPTN Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human OPTN |
Rabbit anti-OPTN Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human OPTN |
Rabbit Polyclonal Anti-OPTN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: SHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTEN |
Rabbit Polyclonal Anti-OPTN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS |
Rabbit Polyclonal Anti-OPTN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OPTN Antibody: synthetic peptide directed towards the C terminal of human OPTN. Synthetic peptide located within the following region: SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII |
Carrier-free (BSA/glycerol-free) OPTN mouse monoclonal antibody,clone OTI7H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
OPTN mouse monoclonal antibody,clone OTI7H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
OPTN mouse monoclonal antibody,clone OTI7H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |