Antibodies

Jump to Filters
View as table Download
PBX3 Rabbit Polyclonal Antibody
TA329893

USD 310.00

5 Days

Rabbit Polyclonal Anti-PBX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PBX3 antibody: synthetic peptide directed towards the N terminal of human PBX3. Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM
PBX3 Rabbit Polyclonal Antibody
TA379665

USD 220.00

3 Weeks

PBX3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of Human PBX3.
Modifications Unmodified