PBX3 Rabbit Polyclonal Antibody

CAT#: TA329893

Rabbit Polyclonal Anti-PBX3 Antibody

Product Images

WB Suggested Anti-PBX3 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PBX3 antibody: synthetic peptide directed towards the N terminal of human PBX3. Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: PBX homeobox 3
• Database Link:
  NP_001128250
  Entrez Gene 5090 Human
  UniProt ID P40426
• Background: PBX3 is a transcriptional activator that binds the sequence 5'-ATCAATCAA-3'.
• Synonyms: OTTHUMP00000022145; OTTHUMP00000064213; pre-B-cell leukemia homeobox 3; pre-B-cell leukemia transcription factor 3
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Transcription Factors