Antibodies

View as table Download

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)

Rabbit anti-PFKM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PFKM

Rabbit Polyclonal Anti-PFKM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA

PFKM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PFKM