Antibodies

Jump to Filters
View as table Download
PIP5K1 beta (PIP5K1B) Rabbit Polyclonal Antibody
TA331347

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ
PIP5K1 beta (PIP5K1B) Rabbit Polyclonal Antibody
TA379962

USD 220.00

3 Weeks

PIP5K1B Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-470 of human PIP5K1B (NP_003549.1).
Modifications Unmodified