PIP5K1 beta (PIP5K1B) Rabbit Polyclonal Antibody

CAT#: TA331347

Rabbit Polyclonal Anti-PIP5K1B Antibody

Product Images

WB Suggested Anti-PIP5K1B Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: phosphatidylinositol-4-phosphate 5-kinase type 1 beta
• Database Link:
  NP_003549
  Entrez Gene 8395 Human
  UniProt ID O14986
• Background: PIP5K1B participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. It mediates RAC1-dependent reorganization of actin filaments and contributes to the activation of PLD2. Together with PIP5K1A is required after stimulation of G-protein coupled receptors for stable platelet adhesion.
• Synonyms: MSS4; STM7
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis, Fc gamma R-mediated phagocytosis, Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton