Antibodies

View as table Download

Rabbit Polyclonal Retinol Binding Protein RBP Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

Rabbit Polyclonal Anti-RBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBP1 antibody: synthetic peptide directed towards the middle region of human RBP1. Synthetic peptide located within the following region: IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Goat Polyclonal Antibody against RBP1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence VEGVVCKQVFKKVQ, from the C Terminus of the protein sequence according to NP_002890.1.

Carrier-free (BSA/glycerol-free) RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RBP1

RBP1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 63-197 of human RBP1 (NP_002890.2).
Modifications Unmodified

RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBP1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RBP1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated