Rabbit Polyclonal RNASET2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RNASET2 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human RNASET2. |
Rabbit Polyclonal RNASET2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RNASET2 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human RNASET2. |
Rabbit Polyclonal Anti-RNASET2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RNASET2 Antibody: synthetic peptide directed towards the middle region of human RNASET2. Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI |