Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody

CAT#: TA332101

Rabbit Polyclonal Anti-RNASET2 Antibody

Product Images

WB Suggested Anti-RNASET2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysateRNASET2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

• 

  Rabbit Anti-RNASET2 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in in alveolar cells, type I and II; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody:

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RNASET2 Antibody: synthetic peptide directed towards the middle region of human RNASET2. Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: ribonuclease T2
• Database Link:
  NP_003721
  Entrez Gene 8635 Human
  UniProt ID O00584
• Background: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
• Synonyms: bA514O12.3; RNASE6PL
• Note: Immunogen sequence homology: Human: 100%; Dog: 79%; Horse: 79%; Rat: 75%

Reference Data

• Protein Families: Secreted Protein