Antibodies

Jump to Filters
View as table Download
NKCC1 (SLC12A2) Rabbit Polyclonal Antibody
TA328693

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-NKCC1 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RRQAMKEMSIDQAK, corresponding to amino acid residues 828-841 of human NKCC1. 6th extracellular loop.
NKCC1 (SLC12A2) Rabbit Polyclonal Antibody
TA334126

USD 310.00

5 Days

Rabbit Polyclonal Anti-SLC12A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC12A2 Antibody: synthetic peptide directed towards the C terminal of human SLC12A2. Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
NKCC1 (SLC12A2) Rabbit Polyclonal Antibody
TA356361

USD 360.00

5 Days

SLC12A2 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC12A2
NKCC1 (SLC12A2) Rabbit Polyclonal Antibody
TA381540

USD 220.00

3 Weeks

SLC12A2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human SLC12A2 (NP_001037.1).
Modifications Unmodified