NKCC1 (SLC12A2) Rabbit Polyclonal Antibody

CAT#: TA334126

Rabbit Polyclonal Anti-SLC12A2 Antibody

Product Images

WB Suggested Anti-SLC12A2 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1:1562500; Positive Control: DLD1 cell lysateSLC12A2 is supported by BioGPS gene expression data to be expressed in DLD1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC12A2 Antibody: synthetic peptide directed towards the C terminal of human SLC12A2. Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 131 kDa
• Gene Name: solute carrier family 12 member 2
• Database Link:
  NP_001037
  Entrez Gene 6558 Human
  UniProt ID P55011
• Background: By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia (Payne et al., 1995). See also SLC12A1 (MIM 600839) and SLC12A3 (MIM 600968). [supplied by OMIM]
• Synonyms: BSC; BSC2; NKCC1; PPP1R141
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Vibrio cholerae infection