Antibodies

View as table Download

Rabbit Polyclonal anti-SP7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SP7 antibody: synthetic peptide directed towards the C terminal of human SP7. Synthetic peptide located within the following region: RTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSP

Rabbit Polyclonal Anti-SP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SP7 antibody: synthetic peptide directed towards the N terminal of human SP7. Synthetic peptide located within the following region: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSV

Rabbit Polyclonal anti-SP7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SP7 antibody: synthetic peptide directed towards the C terminal of human SP7. Synthetic peptide located within the following region: RTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSP

SP7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SP7.