Rabbit Polyclonal Anti-ST8SIA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST8SIA4 antibody: synthetic peptide directed towards the middle region of human ST8SIA4. Synthetic peptide located within the following region: DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM |
Rabbit Polyclonal Anti-St8sia4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-St8sia4 antibody is: synthetic peptide directed towards the C-terminal region of Rat St8sia4. Synthetic peptide located within the following region: GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA |
Rabbit polyclonal ST8SIA4 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ST8SIA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-214 amino acids from the Central region of human ST8SIA4. |
ST8SIA4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ST8SIA4 |
ST8SIA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-168 of human ST8SIA4 (NP_778222.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
