Antibodies

View as table Download

Rabbit Polyclonal Anti-UBN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBN1 antibody: synthetic peptide directed towards the C terminal of human UBN1. Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM

Goat Anti-UBN/ Ubinuclein 1 & 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNSEAYDELVPASLT, from the internal region of the protein sequence according to NP_058632.2.