UBN1 Rabbit Polyclonal Antibody

CAT#: TA342459

Rabbit Polyclonal Anti-UBN1 Antibody

Product Images

WB Suggested Anti-UBN1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate.UBN1 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBN1 antibody: synthetic peptide directed towards the C terminal of human UBN1. Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 121 kDa
• Gene Name: ubinuclein 1
• Database Link:
  NP_058632
  Entrez Gene 29855 Human
  UniProt ID Q9NPG3
• Background: UBN1 may be required for replication-independent chromatin assembly.
• Synonyms: VT; VT4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Rabbit: 86%