Antibodies

Jump to Filters
View as table Download
VSIG8 Rabbit Polyclonal Antibody
TA336094

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-VSIG8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VSIG8 Antibody: synthetic peptide directed towards the N terminal of human VSIG8. Synthetic peptide located within the following region: HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
VSIG8 Rabbit Polyclonal Antibody
TA350603

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-VSIG8 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VSIG8