VSIG8 Rabbit Polyclonal Antibody

CAT#: TA336094

Rabbit Polyclonal Anti-VSIG8 Antibody

Product Images

WB Suggested Anti-VSIG8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-VSIG8 Antibody: synthetic peptide directed towards the N terminal of human VSIG8. Synthetic peptide located within the following region: HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: V-set and immunoglobulin domain containing 8
• Database Link:
  NP_001013683
  Entrez Gene 391123 Human
  UniProt ID P0DPA2
• Background: VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.
• Synonyms: OTTHUMP00000033460; V-set and immunoglobulin domain containing 8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane