Antibodies

View as table Download

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2. Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME

Rabbit polyclonal anti-ZEB2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZEB2.

Rabbit Polyclonal ZEB2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZEB2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ZEB2.

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 Antibody: A synthesized peptide derived from human ZEB2

Rabbit Polyclonal Anti-ZFHX1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFHX1B antibody: synthetic peptide directed towards the N terminal of human ZFHX1B. Synthetic peptide located within the following region: NVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALL

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the N terminal of human ZEB2. Synthetic peptide located within the following region: SETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEE

Goat Anti-ZEB2 (aa545-558) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDSRRQISNIKKEK, from the internal region of the protein sequence according to NP_055610.1; NP_001165124.1.

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ZEB2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1050-1214 of human ZEB2 (NP_055610.1).
Modifications Unmodified

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated