Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal Anti-DCXR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
UGT1A9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A9 |
AKR1B1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AKR1B1 |
beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Porcine |
Immunogen | KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase |
Rabbit polyclonal anti-GUSB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit polyclonal AKR1B1 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This AKR1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 290-316 amino acids from the C-terminal region of human AKR1B1. |
Rabbit Polyclonal Anti-AKR1B1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN |
Rabbit Polyclonal Anti-AKR1B1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI |
Rabbit Polyclonal Anti-UGP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGP2 antibody: synthetic peptide directed towards the N terminal of human UGP2. Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN |
AKR1B1 mouse monoclonal antibody, clone 2D12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit polyclonal anti-AKR1B1 antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AKR1B1. |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR |
beta glucuronidase (GUSB) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 514-544 amino acids from the C-terminal region of Human Beta-glucuronidase |
Goat Polyclonal Antibody against DCXR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1. |
Rabbit Polyclonal Anti-GUSB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH |
Rabbit polyclonal antibody to XYLB (xylulokinase homolog (H. influenzae))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 473 and 536 of XYLB (Uniprot ID#O75191) |
Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1) |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
Mouse Monoclonal AKR1B1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal AKR1B1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
Rabbit Polyclonal Anti-UGP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UGP2 |
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |