UGT (UGT2B4) Rabbit Polyclonal Antibody

CAT#: TA338455

Rabbit Polyclonal Anti-UGT2B4 Antibody

Product Images

WB Suggested Anti-UGT2B4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: UDP glucuronosyltransferase family 2 member B4
• Database Link:
  NP_066962
  Entrez Gene 7363 Human
  UniProt ID P06133
• Background: UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics (such as 4-methylumbelliferone, 1-naphthol, 4-nitrophenol, 2-aminophenol, 4-hydroxybiphenyl and menthol). It is capable of 6 alpha-hydroxyglucuronidation of hyodeoxycholic acid.
• Synonyms: HLUG25; UDPGT2B4; UDPGTh-1; UDPGTH1; UGT2B11
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism