Antibodies

Jump to Filters
View as table Download
ABCF3 Rabbit Polyclonal Antibody
TA310032

USD 205.00

3 Weeks

Rabbit anti-ABCF3 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCF3.
ABCF3 Rabbit Polyclonal Antibody
TA331865

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCF3 Antibody: synthetic peptide directed towards the N terminal of human ABCF3. Synthetic peptide located within the following region: DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL