ABCF3 Rabbit Polyclonal Antibody

CAT#: TA331865

Rabbit Polyclonal Anti-ABCF3 Antibody

Product Images

WB Suggested Anti-ABCF3 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate; ABCF3 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ABCF3 Antibody: synthetic peptide directed towards the N terminal of human ABCF3. Synthetic peptide located within the following region: DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: ATP binding cassette subfamily F member 3
• Database Link:
  NP_060828
  Entrez Gene 55324 Human
  UniProt ID Q9NUQ8
• Background: ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.
• Synonyms: EST201864
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome