Aquaporin 5 (AQP5) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse AQP5, identical to the related rat sequence. |
Rabbit Polyclonal Anti-AQP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AQP5 Antibody is: synthetic peptide directed towards the C-terminal region of Human AQP5. Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE |
Aquaporin 5 (AQP5) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 227-256 amino acids from the C-terminal region of human AQP5 |
Germany
Japan
United Kingdom
China
