Antibodies

Jump to Filters
View as table Download
CCNL2 (Center) Rabbit Polyclonal Antibody
AP50820PU-N

USD 450.00

2 Weeks

CCNL2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 345-374 amino acids from the Central region of human CCNL2
CCNL2 Rabbit Polyclonal Antibody
TA339761

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNL2 antibody: synthetic peptide directed towards the N terminal of human CCNL2. Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR