Kv4.2 (KCND2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 122-151 amino acids from the N-terminal region of human KCND2 |
Kv4.2 (KCND2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 122-151 amino acids from the N-terminal region of human KCND2 |
Rabbit Polyclonal Anti-KCND2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCND2 antibody: synthetic peptide directed towards the middle region of human KCND2. Synthetic peptide located within the following region: RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL |