Antibodies

Jump to Filters
View as table Download
MPRIP Rabbit Polyclonal Antibody
TA344565

USD 475.00

5 Days

Rabbit Polyclonal Anti-MPRIP Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Mprip antibody is: synthetic peptide directed towards the middle region of Rat Mprip. Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV
MPRIP Rabbit Polyclonal Antibody
TA315225

USD 345.00

4 Weeks

Rabbit polyclonal anti-MRIP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MRIP.