MPRIP Rabbit Polyclonal Antibody

CAT#: TA344565

Rabbit Polyclonal Anti-MPRIP Antibody - middle region

Product Images

Host: Rabbit; Target Name: Mprip; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mprip antibody is: synthetic peptide directed towards the middle region of Rat Mprip. Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 113 kDa
• Gene Name: myosin phosphatase Rho interacting protein
• Database Link:
  NP_958431
  Entrez Gene 116504 Rat
  UniProt ID Q6WCQ1
• Background: Mouse homolog binds F-actin and may play a role in F-actin bundling and cytoskeleton organization.
• Synonyms: M-RIP; MRIP; p116Rip; RHOIP3; RIP3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome