Antibodies

Jump to Filters
View as table Download
OLFM4 Rabbit Polyclonal Antibody
TA336996

USD 465.00

5 Days

Rabbit Polyclonal OLFM4 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids between 400 and 450 of human OLFM4 was used as immunogen for this antibody.
OLFM4 Rabbit Polyclonal Antibody
TA339890

USD 310.00

5 Days

Rabbit Polyclonal Anti-OLFM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OLFM4 antibody: synthetic peptide directed towards the C terminal of human OLFM4. Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN
OLFM4 Rabbit Polyclonal Antibody
TA350252

USD 345.00

In Stock

Rabbit Polyclonal Anti-OLFM4 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLFM4