Antibodies

View as table Download

Rabbit polyclonal antibody to protein kinase N2 (protein kinase N2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 46 and 366 of PRK2 (Uniprot ID#Q16513)

Rabbit Polyclonal Anti-PKN2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pkn2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Pkn2. Synthetic peptide located within the following region: LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE

PKN2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated