RIOK2 mouse monoclonal antibody,clone 3E11, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | HRP |
RIOK2 mouse monoclonal antibody,clone 3E11, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | HRP |
Rabbit Polyclonal Anti-RIOK2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the middle region of human RIOK2. Synthetic peptide located within the following region: IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD |
Rabbit Polyclonal Anti-RIOK2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the N terminal of human RIOK2. Synthetic peptide located within the following region: SDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRL |
Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody,clone 2F4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
RIOK2 mouse monoclonal antibody,clone 2F4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
RIOK2 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody,clone 3F6, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
RIOK2 mouse monoclonal antibody,clone 3F6, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
RIOK2 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIOK2 mouse monoclonal antibody,clone 3E11, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Biotin |
RIOK2 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
RIOK2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
RIOK2 mouse monoclonal antibody,clone 5D11, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
RIOK2 mouse monoclonal antibody,clone 5D11, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
RIOK2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |