Antibodies

Jump to Filters
View as table Download
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA328703

USD 585.00

In Stock

Rabbit Polyclonal Anti-Human NaV1.5

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with amino acid residues 1978-2016 of human Nav1.5. Intracellular, C-terminus.
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA314511

USD 345.00

4 Weeks

Rabbit polyclonal Sodium Channel-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human sodium channel.
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA338381

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody is: synthetic peptide directed towards the C-terminal region of Human SCN5A. Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA338791

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A. Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA338380

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI5E9]
CF815385

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI5E9

Applications WB
Reactivities Human
Conjugation Unconjugated
Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
CF815388

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI4B11

Applications WB
Reactivities Human
Conjugation Unconjugated
Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI5E9]
TA815385

USD 379.00

2 Weeks

SCN5A mouse monoclonal antibody,clone OTI5E9

Applications WB
Reactivities Human
Conjugation Unconjugated
Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI5E9]
TA815385S

USD 150.00

2 Weeks

SCN5A mouse monoclonal antibody,clone OTI5E9

Applications WB
Reactivities Human
Conjugation Unconjugated
Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
TA815388

USD 379.00

2 Weeks

SCN5A mouse monoclonal antibody,clone OTI4B11

Applications WB
Reactivities Human
Conjugation Unconjugated
Nav1.5 (SCN5A) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
TA815388S

USD 150.00

2 Weeks

SCN5A mouse monoclonal antibody,clone OTI4B11

Applications WB
Reactivities Human
Conjugation Unconjugated