Antibodies

Jump to Filters
View as table Download
USP38 Rabbit Polyclonal Antibody
TA312644

USD 345.00

In Stock

Rabbit polyclonal anti-USP38 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human USP38.
USP38 Rabbit Polyclonal Antibody
TA342575

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP38 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP38 antibody: synthetic peptide directed towards the middle region of human USP38. Synthetic peptide located within the following region: LVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEK
USP38 Mouse Monoclonal Antibody [Clone ID: OTI1D11]
TA500312

USD 379.00

In Stock

USP38 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
USP38 Mouse Monoclonal Antibody [Clone ID: OTI1D11]
TA500312S

USD 159.00

2 Days

USP38 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated